Record in detail
- Enzy_Id:EN41391333
Name:LYSCN_BOVIN
FullName:Lysozyme C, non-stomach isozyme
Producer Organism:Bos taurus
Sequence Length:148
Mass:16476
Isoelectric Point:7.98
Target:Gram-positive bacteria
Link:P80189 - Function:Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- MKALLILGLLLFSVAVQGKVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQA TNYNAGDQSTDYGIFQINSHWWCNDGKTPGAVNACHLPCGALLQDDITQAVACAKRVVSD PQGIRAWVAWRSHCQNQDLTSYIQGCGV
- Domains
- 1 Name:Glyco_hydro_22 Interpro Link:IPR001916
- 2 Name:Glyco_hydro_22_CS Interpro Link:IPR019799
- 3 Name:Glyco_hydro_22_lys Interpro Link:IPR000974
- 4 Name:Lysozyme-like_dom Interpro Link:IPR023346
- Structures
No structs found on enzybiotics database
- Reference
- [1] Seyfert H.-M.,Senft B.,Hobom G.,Henke M.,
- Title:Structural deviations in a bovine low expression lysozyme-encoding gene active in tissues other than stomach.
- Journal:Gene,1996,(178):131-137 [MEDLINE:97080559]
- [2] Seyfert H.M.,Goldammer T.,Guerin G.,Henke M.,Brunner R.M.,
- Title:The macrophage expressed variant of the bovine lysozyme-encoding gene maps to chromosome 5q23.
- Journal:Mamm. Genome,1994,(5):834-834 [PubMed:7894180]
- [3] Seyfert H.-M.,Senft B.,Steinhoff U.M.,
- Title:Lysozyme-encoding bovine cDNAs from neutrophile granulocytes and mammary gland are derived from a different gene than stomach lysozymes.
- Journal:Gene,1994,(143):271-276 [MEDLINE:94266165]
- [4] Kai H.,Shinbrot E.,Gallup M.,Irwin D.M.,Takeuchi K.,
- Title:Multiple cDNA sequences of bovine tracheal lysozyme.
- Journal:J. Biol. Chem.,1993,(268):27440-27446 [PubMed:8262986]
- [5] Ueda T.,Yoshikawa A.,Nakamura M.,Yamada H.,Ito Y.,
- Title:The primary structures and properties of non-stomach lysozymes of sheep and cow, and implication for functional divergence of lysozyme.
- Journal:Eur. J. Biochem.,1993,(213):649-658 [MEDLINE:93238751]