Record in detail
- Enzy_Id:EN4499312
Name:LYZ1_MOUSE
FullName:Lysozyme C-1
Producer Organism:Mus musculus
Sequence Length:148
Mass:16794
Isoelectric Point:9.7
Target:Gram-positive bacteria
Link:P17897 - Function:Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Lyz1 is active against a range of Gram-postive and Gram-negative bacteria. Less effective than Lyz2 in killing Gram-negative bacteria. Lyz1 and Lyz2 are equally effective in killing Gram-positive bacteria.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRA TNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRD PQGIRAWVAWRTQCQNRDLSQYIRNCGV
- Domains
- 1 Name:Glyco_hydro_22 Interpro Link:IPR001916
- 2 Name:Glyco_hydro_22_CS Interpro Link:IPR019799
- 3 Name:Glyco_hydro_22_lys Interpro Link:IPR000974
- 4 Name:Lysozyme-like_dom Interpro Link:IPR023346
- Structures
No structs found on enzybiotics database
- Reference
- [1]
- Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
- Journal:Genome Res.,2004,(14):2121-2127 [PubMed:15489334]
- [2] Weaver T.E.,Na C.-L.,Graf T.,Faust N.,Markart P.,
- Title:Comparison of the microbicidal and muramidase activities of mouse lysozyme M and P.
- Journal:Biochem. J.,2004,(380):385-392 [PubMed:14977423]
- [3] Wilson A.C.,Cortopassi G.A.,
- Title:Recent origin of the P lysozyme gene in mice.
- Journal:Nucleic Acids Res.,1990,(18):1911-1911 [MEDLINE:90245605]
- [4] Renkawitz R.,Cross M.,
- Title:Repetitive sequence involvement in the duplication and divergence of mouse lysozyme genes.
- Journal:EMBO J.,1990,(9):1283-1288 [MEDLINE:90214640]