Record in detail
- Enzy_Id:EN50664856
Name:LYZ2_MOUSE
FullName:Lysozyme C-2
Producer Organism:Mus musculus
Sequence Length:148
Mass:16689
Isoelectric Point:8.91
Target:Gram-positive bacteria
Link:P08905 - Function:Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Lyz2 is active against a range of Gram-positive and Gram-negative bacteria. More effective than Lyz1 in killing Gram-negative bacteria. Lyz1 and Lyz2 are equally effective in killing Gram-positive bacteria.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- MKTLLTLGLLLLSVTAQAKVYERCEFARTLKRNGMAGYYGVSLADWVCLAQHESNYNTRA TNYNRGDQSTDYGIFQINSRYWCNDGKTPRAVNACGINCSALLQDDITAAIQCAKRVVRD PQGIRAWVAWRAHCQNRDLSQYIRNCGV
- Domains
- 1 Name:Glyco_hydro_22 Interpro Link:IPR001916
- 2 Name:Glyco_hydro_22_CS Interpro Link:IPR019799
- 3 Name:Glyco_hydro_22_lys Interpro Link:IPR000974
- 4 Name:Lysozyme-like_dom Interpro Link:IPR023346
- Structures
- 1
1IVMMethod:NMR
Chains:A=19-148
- Reference
- [1] Frith M.C.,Gough J.,Katayama S.,Kasukawa T.,Carninci P.,
- Title:The transcriptional landscape of the mammalian genome.
- Journal:Science,2005,(309):1559-1563 [PubMed:16141072]
- [2] Liu L.,Liao H.-I.,Gabayan V.,Thapa D.R.,Cole A.M.,
- Title:Decreased clearance of Pseudomonas aeruginosa from airways of mice deficient in lysozyme M.
- Journal:J. Leukoc. Biol.,2005,(78):1081-1085 [PubMed:16204648]
- [3]
- Title:The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
- Journal:Genome Res.,2004,(14):2121-2127 [PubMed:15489334]
- [4] Akinbi H.T.,Weaver T.E.,Korfhagen T.R.,Markart P.,
- Title:Mouse lysozyme M is important in pulmonary host defense against Klebsiella pneumoniae infection.
- Journal:Am. J. Respir. Crit. Care Med.,2004,(169):454-458 [PubMed:14617511]
- [5] Weaver T.E.,Na C.-L.,Graf T.,Faust N.,Markart P.,
- Title:Comparison of the microbicidal and muramidase activities of mouse lysozyme M and P.
- Journal:Biochem. J.,2004,(380):385-392 [PubMed:14977423]
- [6] Pederson B.,Clausen B.E.,Kim H.R.,Chi H.H.,Sinha P.,
- Title:Mouse lysozyme-M knockout mice reveal how the self-determinant hierarchy shapes the T cell repertoire against this circulating self antigen in wild-type mice.
- Journal:J. Immunol.,2004,(173):1763-1771 [PubMed:15265906]
- [7] Oren A.,Liu L.,Liao H.-I.,Gabayan V.,Ganz T.,
- Title:Increased inflammation in lysozyme M-deficient mice in response to Micrococcus luteus and its peptidoglycan.
- Journal:Blood,2003,(101):2388-2392 [PubMed:12411294]
- [8] Imoto T.,Ueda T.,Obita T.,
- Title:Solution structure and activity of mouse lysozyme M.
- Journal:Cell. Mol. Life Sci.,2003,(60):176-184 [PubMed:12613666]
- [9] Renkawitz R.,Wedel A.,Mangelsdorf I.,Cross M.,
- Title:Mouse lysozyme M gene: isolation, characterization, and expression studies.
- Journal:Proc. Natl. Acad. Sci. U.S.A.,1988,(85):6232-6236 [MEDLINE:88320416]