Record in detail
- Enzy_Id:EN54165756
Name:LYSCK_SHEEP
FullName:Lysozyme C, kidney isozyme
Producer Organism:Ovis aries
Sequence Length:130
Mass:14611
Isoelectric Point:7.98
Target:Gram-positive bacteria
Link:P80190 - Function:Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- KVFERCELARTLKRFGMDGFRGISLANWMCLARWESSYNTQATNYNSGDRSTDYGIFQIN SHWWCNDGKTPGAVNACHIPCSALLQDDITQAVACAKRVVSDPQGIRAWVAWRSHCQNQD LTSYIQGCGV
- Domains
- 1 Name:Glyco_hydro_22 Interpro Link:IPR001916
- 2 Name:Glyco_hydro_22_CS Interpro Link:IPR019799
- 3 Name:Glyco_hydro_22_lys Interpro Link:IPR000974
- 4 Name:Lysozyme-like_dom Interpro Link:IPR023346
- Structures
No structs found on enzybiotics database
- Reference
- [1] Irwin D.M.
- Title:Evolution of the bovine lysozyme gene family: changes in gene expression and reversion of function.
- Journal:J. Mol. Evol.,1995,(41):299-312 [MEDLINE:96054033]
- [2] Ueda T.,Yoshikawa A.,Nakamura M.,Yamada H.,Ito Y.,
- Title:The primary structures and properties of non-stomach lysozymes of sheep and cow, and implication for functional divergence of lysozyme.
- Journal:Eur. J. Biochem.,1993,(213):649-658 [MEDLINE:93238751]