Record in detail
- Enzy_Id:EN6984837
Name:MEPA_ECOLI
FullName:Penicillin-insensitive murein endopeptidase,MepA
Producer Organism:Escherichia coli (strain K12)
Sequence Length:274
Mass:30137
Isoelectric Point:8.4
Target:E. coli
Link:P0C0T5 - Function:Involved in the removal of murein from the sacculus. May also facilitate integration of nascent murein strands into the sacculus by cleaving the peptide bonds between neighboring strands in mature murein.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- MNKTAIALLALLASSASLAATPWQKITQPVPGSAQSIGSFSNGCIVGADTLPIQSEHYQV MRTDQRRYFGHPDLVMFIQRLSSQVSNLGMGTVLIGDMGMPAGGRFNGGHASHQTGLDVD IFLQLPKTRWTSAQLLRPQALDLVSRDGKHVVSTLWKPEIFSLIKLAAQDKDVTRIFVNP AIKQQLCLDAGTDRDWLRKVRPWFQHRAHMHVRLRCPADSLECEDQPLPPSGDGCGAELQ SWFEPPKPGTTKPEKKTPPPLPPSCQALLDEHVI
- Domains
- 1 Name:Hedgehog/DD-peptidase Interpro Link:IPR009045
- 2 Name:Peptidase_M74 Interpro Link:IPR005073
- Structures
- Reference
- [1] Isono K.,Fujita K.,Yamamoto Y.,Morooka N.,Hayashi K.,
- Title:Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.
- Journal:Mol. Syst. Biol.,2006,(2):0-0 [PubMed:16738553]
- [2] Bochtler M.,Sabala I.,Odintsov S.G.,Marcyjaniak M.,
- Title:Peptidoglycan amidase MepA is a LAS metallopeptidase.
- Journal:J. Biol. Chem.,2004,(279):43982-43989 [PubMed:15292190]
- [3] Inada T.,Hayashi K.,Baba T.,Aiba H.,Yamamoto Y.,
- Title:Construction of a contiguous 874-kb sequence of the Escherichia coli-K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features.
- Journal:DNA Res.,1997,(4):91-113 [MEDLINE:97349980]
- [4] Burland V.,Perna N.T.,Bloch C.A.,Plunkett G. III,Blattner F.R.,
- Title:The complete genome sequence of Escherichia coli K-12.
- Journal:Science,1997,(277):1453-1474 [MEDLINE:97426617]
- [5] Goodell E.W.,Huber M.,van Leeuwen A.M.,Keck W.,
- Title:Cloning and characterization of mepA, the structural gene of the penicillin-insensitive murein endopeptidase from Escherichia coli.
- Journal:Mol. Microbiol.,1990,(4):209-219 [MEDLINE:90251161]