Record in detail
- Enzy_Id:EN77998942
Name:LYSC_COLVI
FullName:Lysozyme C
Producer Organism:Colinus virginianus
Sequence Length:129
Mass:14271
Isoelectric Point:9.21
Target:Gram-positive bacteria
Link:P00700 - Function:Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNSQATNRNTDGSTDYGVLQINS RWWCNDGKTPGSRNLCNIPCSALLSSDITATVNCAKKIVSDGNGMNAWVAWRNRCKGTDV QAWIRGCRL
- Domains
- 1 Name:Glyco_hydro_22 Interpro Link:IPR001916
- 2 Name:Glyco_hydro_22_CS Interpro Link:IPR019799
- 3 Name:Glyco_hydro_22_lys Interpro Link:IPR000974
- 4 Name:Lysozyme-like_dom Interpro Link:IPR023346
- Structures
- Reference
- [1] Schick K.A.,Davies D.R.,Smith-Gill S.J.,Silverton E.W.,Chacko S.,
- Title:Refined structures of bobwhite quail lysozyme uncomplexed and complexed with the HyHEL-5 Fab fragment.
- Journal:Proteins,1996,(26):55-65 [MEDLINE:97035273]
- [2] Wilson A.C.,Mross G.A.,Arnheim N.,Prager E.M.,
- Title:Amino acid sequence studies on bobwhite quail egg white lysozyme.
- Journal:J. Biol. Chem.,1972,(247):2905-2916 [MEDLINE:72181385]