Record in detail
- Enzy_Id:EN84641242
Name:LYSC_NUMME
FullName:Lysozyme C
Producer Organism:Numida meleagris
Sequence Length:129
Mass:14309
Isoelectric Point:9.46
Target:Gram-positive bacteria
Link:P00704 - Function:Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNSQATNRNTDGSTDYGVLQINS RWWCNDGRTPGSRNLCNIPCSALQSSDITATANCAKKIVSDGNGMNAWVAWRKHCKGTDV RVWIKGCRL
- Domains
- 1 Name:Glyco_hydro_22 Interpro Link:IPR001916
- 2 Name:Glyco_hydro_22_CS Interpro Link:IPR019799
- 3 Name:Glyco_hydro_22_lys Interpro Link:IPR000974
- 4 Name:Lysozyme-like_dom Interpro Link:IPR023346
- Structures
- Reference
- [1] Alzari P.M.,Souchon H.,Lescar J.,
- Title:Crystal structures of pheasant and guinea fowl egg-white lysozymes.
- Journal:Protein Sci.,1994,(3):788-798 [MEDLINE:94339839]
- [2] Kuramoto M.,Araki T.,Torikata T.,Ikeda Y.,Fukamizo T.,
- Title:1H-NMR study on the structure of lysozyme from guinea hen egg white.
- Journal:J. Biochem.,1991,(110):997-1003 [MEDLINE:92176179]
- [3] Jolles P.,Mouton A.,van Leemputten E.,Jolles J.,
- Title:Amino acid sequence of guinea-hen egg-white lysozyme.
- Journal:Biochim. Biophys. Acta,1972,(257):497-510 [MEDLINE:72170113]