Record in detail
- Enzy_Id:EN85515019
Name:LYSC_PAROL
FullName:Lysozyme C
Producer Organism:Paralichthys olivaceus
Sequence Length:143
Mass:16169
Isoelectric Point:7.68
Target:Gram-positive bacteria
Link:Q9DD65 - Function:Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents (By similarity).
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- MRTLVVLLLVAVANARVYERCEWARLLRNQGMDGYRGISLANWVCLTEWESHYNTRATNH NTDGSTDYGIFQINSRWWCNDSQTPTSNACNIRCSELLTDDVIVAIKCAKRVVRDPNGIG AWVAWRQHCQGQDLSSYLAGCGL
- Domains
- 1 Name:Glyco_hydro_22 Interpro Link:IPR001916
- 2 Name:Glyco_hydro_22_lys Interpro Link:IPR000974
- 3 Name:Lysozyme-like_dom Interpro Link:IPR023346
- Structures
No structs found on enzybiotics database
- Reference
- [1] Aoki T.,Hirono I.,Hikima J.,
- Title:Moleculer cloning and novel repeated sequences of a c-type lysozyme gene in Japanese flounder (Paralichthys olivaceus).
- Journal:Mar. Biotechnol.,2000,(2):241-247 [PubMed:10852802]
- [2] Aoki T.,Hirono I.,Hikima J.,
- Title:Characterization and expression of c-type lysozyme cDNA from Japanese flounder (Paralichthys olivaceus).
- Journal:Mol. Mar. Biol. Biotechnol.,1997,(6):339-344 [MEDLINE:98079484]