Record in detail
- Enzy_Id:EN94841256
Name:LYSC_CHRAM
FullName:Lysozyme C
Producer Organism:Chrysolophus amherstiae
Sequence Length:129
Mass:14311
Isoelectric Point:9.19
Target:Gram-positive bacteria
Link:P22910 - Function:Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.
- Antibacterial Activities
No MICs found on enzybiotics database
- Sequence
- KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNTDGSTDYGILQINS RWWCNDGRTPGSRNLCHIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDV NAWTRGCRL
- Domains
- 1 Name:Glyco_hydro_22 Interpro Link:IPR001916
- 2 Name:Glyco_hydro_22_CS Interpro Link:IPR019799
- 3 Name:Glyco_hydro_22_lys Interpro Link:IPR000974
- 4 Name:Lysozyme-like_dom Interpro Link:IPR023346
- Structures
No structs found on enzybiotics database
- Reference
- [1] Torikata T.,Kuramoto M.,Araki T.,
- Title:The amino acid sequence of Lady Amherst"s pheasant (Chrysolophus amherstiae) and golden pheasant (Chrysolophus pictus) egg-white lysozymes.
- Journal:Agric. Biol. Chem.,1990,(54):2299-2308 [MEDLINE:91136781]